Record in detail


General Info

  • lamp_id:L11A009050
  • Name:Cliotide T13
  • FullName:
  • Source: Clitoria ternatea
  • Mass:3324.8 Da
  • Sequence Length:31 aa
  • Isoelectric Point:4.19
  • Activity:Gram+Gram-
  • Sequence
        DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9050

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009050    From 1 To 31 E-value: 0.0000000000007 Score: 64.3
        DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN
  • 2. L11A009051    From 1 To 31 E-value: 0.00000000008 Score: 57.8
        DTIPCGESCVWIPCISSILGCSCKDKVCYHN
  • 3. L12A05610|    From 64 To 91 E-value: 0.0000000001 Score: 56.6
        PCGESCVFIPCISSVLGCSCKNKVCYRN
  • 4. L06AT00180    From 2 To 30 E-value: 0.0000000003 Score: 55.5
        TPCGESCVWIPCISSAVGCSCKNKVCYKN
  • 5. L06AT00183    From 2 To 31 E-value: 0.0000000005 Score: 55.1
        TLPCGESCVWIPCISSVVGCSCKSKVCYKN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Pane K, Sgambati V, Zanfardino A, Smaldone G, Cafaro V, Angrisano T, Pedone E, Di Gaetano S, Capasso
  •   Title:A new cryptic cationic antimicrobial peptide (AMP) from human apolipoprotein E with anti-bacterial activity and immunomodulatory effects on human cells
  •   Journal:FEBS J, 2016  [:27028511]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: