Record in detail


General Info

  • lamp_id:L11A009051
  • Name:Cliotide T14
  • FullName:
  • Source: Clitoria ternatea
  • Mass:3374.9 Da
  • Sequence Length:31 aa
  • Isoelectric Point:5.51
  • Activity:Gram+Gram-
  • Sequence
        DTIPCGESCVWIPCISSILGCSCKDKVCYHN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9051

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009051    From 1 To 31 E-value: 0.0000000000005 Score: 65.1
        DTIPCGESCVWIPCISSILGCSCKDKVCYHN
  • 2. L12A05610|    From 63 To 91 E-value: 0.00000000002 Score: 59.3
        IPCGESCVFIPCISSVLGCSCKNKVCYRN
  • 3. L11A009050    From 1 To 31 E-value: 0.00000000008 Score: 57.8
        DTTPCGESCVWIPCVSSIVGCSCQNKVCYQN
  • 4. L06AT00183    From 1 To 31 E-value: 0.0000000002 Score: 55.8
        GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
  • 5. L06AT00163    From 1 To 31 E-value: 0.0000000004 Score: 55.1
        GTLPCGESCVWIPCISAVVGCSCKSKVCYKN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Pane K, Sgambati V, Zanfardino A, Smaldone G, Cafaro V, Angrisano T, Pedone E, Di Gaetano S, Capasso
  •   Title:A new cryptic cationic antimicrobial peptide (AMP) from human apolipoprotein E with anti-bacterial activity and immunomodulatory effects on human cells
  •   Journal:FEBS J, 2016  [:27028511]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: