Record in detail


General Info

  • lamp_id:L11A009206
  • Name:Gallerimycin
  • FullName:
  • Source: Galleria mellonella
  • Mass:6419.3 Da
  • Sequence Length:57 aa
  • Isoelectric Point:8.37
  • Activity:Gram+Gram-Fungus
  • Sequence
        IEFEKSTESHDIQKRGVTITVKPPFPGCVFYECIANCRSRGYKNGGYCTINGCQCLR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9206

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002965    From 20 To 76 E-value: 3e-30 Score: 122
        IEFEKSTESHDIQKRGVTITVKPPFPGCVFYECIANCRSRGYKNGGYCTINGCQCLR
  • 2. L11A009206    From 1 To 57 E-value: 2e-29 Score: 119
        IEFEKSTESHDIQKRGVTITVKPPFPGCVFYECIANCRSRGYKNGGYCTINGCQCLR
  • 3. L03A000150    From 20 To 70 E-value: 2e-26 Score: 109
        IEFEKSTESHDIQKRGVTITVKPPFPGCVFYECIANCRSRGYKNGGYCTIN
  • 4. L02A001371    From 1 To 42 E-value: 2e-20 Score: 89
        GVTITVKPPFPGCVFYECIANCRSRGYKNGGYCTINGCQCLR
  • 5. L05ADEF547    From 62 To 86 E-value: 0.099 Score: 27.3
        CAANCKRLGFR-GGWCTTGNTCRCFR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Schuhmann B, Seitz V, Vilcinskas A, Podsiadlowski L
  •   Title:Cloning and expression of gallerimycin, an antifungal peptide expressed in immune response of greater wax moth larvae, Galleria mellonella
  •   Journal:Arch Insect Biochem Physiol, 2003, 53, 125-133  [:12811766]
  •   [2]  Moghaddam MR, Tonk M, Schreiber C, Salzig D, Czermak P, Vilcinskas A, Rahnamaeian M
  •   Title:The potential of the Galleria mellonella innate immune system is maximized by the co-presentation of diverse antimicrobial peptides
  •   Journal:Biol Chem, 2016  [:27105487]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: