Record in detail


General Info

  • lamp_id:L11A009207
  • Name:Cobatoxin-like protein
  • FullName:
  • Source: Galleria mellonella
  • Mass:3813.2 Da
  • Sequence Length:35 aa
  • Isoelectric Point:7.76
  • Activity:Gram+Gram-
  • Sequence
        MELRGCNNSGCDSVCRALGFNHGRCVSADTCRCYN
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9207

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009207    From 1 To 35 E-value: 0.000000000000002 Score: 72.8
        MELRGCNNSGCDSVCRALGFNHGRCVSADTCRCYN
  • 2. L05ADEF544    From 55 To 88 E-value: 0.000002 Score: 43.1
        MRVSSCSDGICDLGCKILGYPHGRCISANTCQCY
  • 3. L05ADEF547    From 61 To 85 E-value: 0.011 Score: 30.4
        GCAANCKRLGFRGGWCTTGNTCRCF
  • 4. L05ADEF404    From 4 To 31 E-value: 0.093 Score: 27.3
        CAKKSCDSWCRRLDYPGGECVTKWKCSC
  • 5. L12A06219|    From 49 To 80 E-value: 0.14 Score: 26.9
        NNTNCKNVCRTEGFPTGSCDFHVAGRKCYCYK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Moghaddam MR, Tonk M, Schreiber C, Salzig D, Czermak P, Vilcinskas A, Rahnamaeian M
  •   Title:The potential of the Galleria mellonella innate immune system is maximized by the co-presentation of diverse antimicrobial peptides
  •   Journal:Biol Chem, 2016  [:27105487]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: