Record in detail


General Info

  • lamp_id:L11A009208
  • Name:Cecropin-A Gm
  • FullName:
  • Source: Galleria mellonella
  • Mass:4215 Da
  • Sequence Length:39 aa
  • Isoelectric Point:10.94
  • Activity:Gram+Gram-ParasiteMammalian Cell
  • Sequence
        KWKIFKKIEKAGRNIRDGIIKAGPAVSVVGEAATIYKTG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9208

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009208    From 1 To 39 E-value: 1e-16 Score: 76.6
        KWKIFKKIEKAGRNIRDGIIKAGPAVSVVGEAATIYKTG
  • 2. L07APD0151    From 1 To 37 E-value: 0.0000000000003 Score: 65.9
        KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYK
  • 3. L12A08526|    From 25 To 61 E-value: 0.0000000000003 Score: 65.5
        RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK
  • 4. L01A002780    From 1 To 37 E-value: 0.0000000000003 Score: 65.5
        KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYK
  • 5. L07APD0178    From 1 To 37 E-value: 0.0000000000003 Score: 65.5
        KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Tonk M, Cabezas-Cruz A, Rahnamaeian M, Khalife J, Vilcinskas A, Pierrot C
  •   Title:The Drosophila melanogaster antimicrobial peptides Mtk-1 and Mtk-2 are active against the malarial parasite Plasmodium falciparum
  •   Journal:Parasitol Res, 2019  [:31001677]
  •   [2]  Moghaddam MR, Tonk M, Schreiber C, Salzig D, Czermak P, Vilcinskas A, Rahnamaeian M
  •   Title:The potential of the Galleria mellonella innate immune system is maximized by the co-presentation of diverse antimicrobial peptides
  •   Journal:Biol Chem, 2016  [:27105487]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: