Record in detail


General Info

  • lamp_id:L11A009209
  • Name:Recombinant Diapausin-1
  • FullName:
  • Source:
  • Mass:5443.1 Da
  • Sequence Length:48 aa
  • Isoelectric Point:8.14
  • Activity:Gram+Gram-Fungus
  • Sequence
        AMAINNWVRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGGMNCYRR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9209

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009209    From 1 To 48 E-value: 2e-24 Score: 102
        AMAINNWVRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGGMNCYRR
  • 2. L12A04800|    From 1 To 45 E-value: 8e-23 Score: 97.4
        INNWVRVPPCDQVCSRSNPEKDECCRAHGHAFHAHCNGGMNCYRR
  • 3. L01A002349    From 1 To 45 E-value: 5e-21 Score: 91.3
        INNWVRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGGMQCYRR
  • 4. L01A000314    From 1 To 40 E-value: 0.000000001 Score: 53.1
        VHVGPCDQVCSRIDPEKDECCRAHGYRGHSSCYYGRMECY
  • 5. L12A07373|    From 26 To 60 E-value: 0.000000003 Score: 52.4
        VRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Al Souhail Q, Hiromasa Y, Rahnamaeian M, Giraldo MC, Takahashi D, Valent B, Vilcinskas A, Kanost MR
  •   Title:Characterization and regulation of expression of an antifungal peptide from hemolymph of an insect, Manduca sexta
  •   Journal:Dev Comp Immunol, 2016, 61, 258-268  [:26976231]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: