Record in detail


General Info

  • lamp_id:L11A009397
  • Name:Defensin Bm (6-40)
  • FullName:
  • Source:
  • Mass:3822.7 Da
  • Sequence Length:35 aa
  • Isoelectric Point:9.94
  • Activity:Gram-
  • Sequence
        PLSCRRKIGICVLIRCSGNMRQIGTCLGALVKCCR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9397

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009397    From 1 To 35 E-value: 0.00000000000004 Score: 68.6
        PLSCRRKIGICVLIRCSGNMRQIGTCLGALVKCCR
  • 2. L12A06026|    From 1 To 34 E-value: 0.00000000001 Score: 60.5
        LSCCRNIGICVLIRCSGNMRQIGTCLGALVKCCR
  • 3. L03A000070    From 17 To 51 E-value: 0.0000000002 Score: 56.2
        PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR
  • 4. L05A0DEF83    From 2 To 36 E-value: 0.0000000003 Score: 55.8
        PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR
  • 5. L01A000584    From 1 To 35 E-value: 0.0000000003 Score: 55.5
        PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Waghu FH, Barai RS, Idicula-Thomas S
  •   Title:Leveraging family-specific signatures for AMP discovery and high-throughput annotation
  •   Journal:Sci Rep, 2016, 6, 24684  [:27089856]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: