Record in detail


General Info

  • lamp_id:L11A009705
  • Name:Piscidin-1, Em-Pis1
  • FullName:
  • Source: Epinephelus malabaricus Epinephelus coioides
  • Mass:5319.2 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.48
  • Activity:Gram+Gram-CancerMammalian Cell
  • Sequence
        FIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9705

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A09005|    From 23 To 67 E-value: 3e-21 Score: 92
        FIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA
  • 2. L11A009705    From 1 To 45 E-value: 8e-21 Score: 90.9
        FIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA
  • 3. L12A09004|    From 23 To 68 E-value: 0.000000000000001 Score: 73.2
        FFFHIIKGLFHAGRMIHGLVNRRRHRHGMEEL-DLDQRAFEREKAFA
  • 4. L11A009708    From 1 To 46 E-value: 0.000000000000002 Score: 72.8
        FFFHIIKGLFHAGRMIHGLVNRRRHRHGMEEL-DLDQRAFEREKAFA
  • 5. L11A010232    From 1 To 46 E-value: 0.000000000000003 Score: 72.4
        FFFHIVKGLFHAGRMIHGLVNRRRHRHGMEEL-DLDQRAFEREKAFA

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Li ZP, Chen DW, Pan YQ, Deng L
  •   Title:Two isoforms of piscidin from Malabar grouper, Epinephelus malabaricus: Expression and functional characterization
  •   Journal:Fish Shellfish Immunol, 2016, 57, 222-235  [:27554395]
  •   [2]  Hu B, Pan Y, Li Z, Yuan W, Deng L
  •   Title:EmPis-1L, an Effective Antimicrobial Peptide Against the Antibiotic-Resistant VBnC State Cells of Pathogenic Bacteria
  •   Journal:Probiotics Antimicrob Proteins, 2018  [:30032476]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: