Record in detail


General Info

  • lamp_id:L11A009743
  • Name:Px Defensin, PxDef
  • FullName:
  • Source: Plutella xylostella
  • Mass:4233.8 Da
  • Sequence Length:37 aa
  • Isoelectric Point:5.59
  • Activity:Gram+Gram-Fungus
  • Sequence
        RIPCQYEDATEDTICQQHCLPKGYSYGICVSYRCSCV
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9743

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009743    From 1 To 37 E-value: 5e-17 Score: 78.2
        RIPCQYEDATEDTICQQHCLPKGYSYGICVSYRCSCV
  • 2. L05ADEF542    From 63 To 99 E-value: 0.000000000002 Score: 63.2
        RIWCQYEEVTEDAICQEHCIPKGYSYGLCISNTCSCI
  • 3. L13A019158    From 1 To 36 E-value: 0.00000000002 Score: 59.3
        VSCDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI
  • 4. L05ADEF405    From 1 To 36 E-value: 0.00000000002 Score: 59.3
        IWCEFEEATETAICQEHCLPKGYSYGICVSNTCSCI
  • 5. L05ADEF540    From 1 To 36 E-value: 0.00000000003 Score: 58.9
        VSCDFEEANEDAVCQEHCLPKGYTYGICVSHTCSCI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Xu XX, Zhang YQ, Freed S, Yu J, Gao YF, Wang S, Ouyang Ln, Ju WY, Jin FL
  •   Title:An anionic defensin from Plutella xylostella with potential activity against Bacillus thuringiensis
  •   Journal:Bull Entomol Res, 2016, 106, 790-800  [:27443911]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: