Record in detail


General Info

  • lamp_id:L11A009759
  • Name:Aa Cecropin 3, Ccrp 3
  • FullName:
  • Source: Anopheles albimanus
  • Mass:3838.6 Da
  • Sequence Length:35 aa
  • Isoelectric Point:11.76
  • Activity:Gram+Gram-
  • Sequence
        APRMEIGKRREKLGRNVFKAAKKALPVIAGYKALG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9759

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A002591    From 26 To 60 E-value: 0.00000000000001 Score: 70.1
        APRMEIGKRREKLGRNVFKAAKKALPVIAGYKALG
  • 2. L11A009759    From 1 To 35 E-value: 0.00000000000003 Score: 68.9
        APRMEIGKRREKLGRNVFKAAKKALPVIAGYKALG
  • 3. L12A10212|    From 6 To 40 E-value: 0.00000000003 Score: 58.9
        APRWKFGKRLEKLGRNVFRAAKKALPVVAGYKALG
  • 4. L01A003754    From 1 To 34 E-value: 0.00000000007 Score: 57.8
        APRWKFGKRLEKLGRNVFRAAKKALPVIAGYKAL
  • 5. L12A08730|    From 28 To 62 E-value: 0.0000000003 Score: 55.5
        APRWKFGKKLEKVGKNVFNAAKKALPVVAGYKALG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Pavon n, Buelna-Chontal M, Hern¨¢ndez-Esquivel L, Hern¨¢ndez S, Ch¨¢vez E, Conde R, Lanz-Mendoza H
  •   Title:Mitochondrial inactivation by Anopheles albimanus cecropin 3: molecular mechanisms
  •   Journal:Peptides, 2014, 53, 202-209  [:23880546]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: