Record in detail


General Info

  • lamp_id:L11A009761
  • Name:Cecropin-D-like peptide [I7K;A10K;A21,22,24R]
  • FullName:
  • Source:
  • Mass:4583.2 Da
  • Sequence Length:39 aa
  • Isoelectric Point:11.25
  • Activity:Gram-Mammalian Cell
  • Sequence
        ENFFKEKERKGQRIRDAIISRRPRVETLAQAQKIIKGGD
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9761

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009761    From 1 To 39 E-value: 6e-17 Score: 77.8
        ENFFKEKERKGQRIRDAIISRRPRVETLAQAQKIIKGGD
  • 2. L01A000175    From 1 To 39 E-value: 0.00000000000008 Score: 67.8
        ENFFKEIERAGQRIRDAIISAAPAVETLAQAQKIIKGGD
  • 3. L11A010398    From 1 To 39 E-value: 0.000000000008 Score: 60.8
        ENFFKRIRRAGKRIRDAIISAAPAVETLAQAQKIIKGGD
  • 4. L11A010399    From 2 To 39 E-value: 0.0000000002 Score: 56.2
        NFFKRIRRAGKRIRKAIISAAPAVETLAQAQKIIKGGD
  • 5. L12A07886|    From 26 To 61 E-value: 0.00000002 Score: 49.3
        DFLKELEGAGQRIRDAIISAQPAVETIAQATAIFKG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Correa W, Manrique-Moreno M, Behrends J, Patino E, Marella C, Pel¨¢ez-Jaramillo C, Garidel P, Gutsma
  •   Title:Galleria mellonella native and analogue peptides Gm1 and ¦¤Gm1
  •   Journal:Biochim Biophys Acta, 2014, 1838, 2739-2744  [:25016054]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: