Record in detail


General Info

  • lamp_id:L11A009781
  • Name:Scorpions-Ticks Defensins Ancestor, STiDA
  • FullName:
  • Source:
  • Mass:6137.1 Da
  • Sequence Length:55 aa
  • Isoelectric Point:9.44
  • Activity:Gram+Gram-Parasite
  • Sequence
        GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIFKQTCKCYKPMGYKTRPPFILG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9781

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009781    From 1 To 55 E-value: 9e-28 Score: 113
        GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIFKQTCKCYKPMGYKTRPPFILG
  • 2. L12A02726|    From 1 To 55 E-value: 9e-27 Score: 110
        GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKTRPPFILG
  • 3. L12A02725|    From 1 To 55 E-value: 2e-26 Score: 108
        GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKARPPFILG
  • 4. L03A000241    From 37 To 73 E-value: 0.00000000003 Score: 58.9
        GFGCPLN---QGACHNHCRSIR-RRGGYCSGIIKQTCTCYR
  • 5. L05ADEF518    From 1 To 37 E-value: 0.00000000007 Score: 57.8
        GFGCPFN---QGACHRHCQSI-GRKGGYCSGLFKQTCTCYR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A,
  •   Title:Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins
  •   Journal:Front Microbiol, 2016, 7, 1682  [:27822206]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: