Record in detail


General Info

  • lamp_id:L11A009920
  • Name:Plantaricin Pln1
  • FullName:
  • Source: Lactobacillus plantarum
  • Mass:4138.7 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.47
  • Activity:Gram+Gram-
  • Sequence
        IWQWIVGGLGFLAGDAWSHSDQISSGIKKRKKKGYGY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  9920

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A009920    From 1 To 37 E-value: 7e-16 Score: 74.3
        IWQWIVGGLGFLAGDAWSHSDQISSGIKKRKKKGYGY
  • 2. L12A07978|    From 23 To 47 E-value: 0.00004 Score: 38.5
        IVAGLGYLVKDAWDHSDQIISGFKK
  • 3. L04ABAC190    From 5 To 29 E-value: 0.00006 Score: 38.1
        IVAGLGYLVKDAWDHSDQIISGFKK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Meng F, Zhao H, Zhang C, Lu F, Bie X, Lu Z
  •   Title:Expression of a novel bacteriocin-the plantaricin Pln1-in Escherichia coli and its functional analysis
  •   Journal:Protein Expr Purif, 2016, 119, 85-93  [:26586613]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: