Record in detail


General Info

  • lamp_id:L11A010234
  • Name:Piscidin-3, ecPis-3
  • FullName:
  • Source: Epinephelus coioides
  • Mass:5530.3 Da
  • Sequence Length:49 aa
  • Isoelectric Point:6.51
  • Activity:Gram+Gram-ParasiteFungusMammalian Cell
  • Sequence
        IFGLLLHGAIHVGKLIHGLVRRHGEEQLDDLEQLDKRALDYNPGRPGFD
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10234

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010234    From 1 To 49 E-value: 4e-23 Score: 98.2
        IFGLLLHGAIHVGKLIHGLVRRHGEEQLDDLEQLDKRALDYNPGRPGFD
  • 2. L12A04578|    From 1 To 23 E-value: 0.0000003 Score: 45.4
        IFGLLLHGAIHVGKLIHGLVRRH
  • 3. L12A09005|    From 27 To 57 E-value: 0.0003 Score: 35.8
        IIKGLFHAGKMIHGLVTRRRHGVEELQDLDQ
  • 4. L11A009705    From 5 To 35 E-value: 0.0003 Score: 35.8
        IIKGLFHAGKMIHGLVTRRRHGVEELQDLDQ
  • 5. L03A000148    From 25 To 60 E-value: 0.0004 Score: 35
        GALIKGAIHGGRFIHGMIQNH--HGYDEQQELNKRAVD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhuang ZR, Yang XD, Huang XZ, Gu HX, Wei HY, He YJ, Deng L
  •   Title:Three new piscidins from orange-spotted grouper (Epinephelus coioides): Phylogeny, expression and functional characterization
  •   Journal:Fish Shellfish Immunol, 2017, 66, 240-253  [:28433718]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: