Record in detail


General Info

  • lamp_id:L11A010236
  • Name:Piscidin-4, ecPis-4
  • FullName:
  • Source: Epinephelus coioides
  • Mass:6318.2 Da
  • Sequence Length:54 aa
  • Isoelectric Point:11.66
  • Activity:Gram+Gram-ParasiteFungusMammalian Cell
  • Sequence
        FFRHIKSFWKGAKAIFRGARQGWREHRALSKQRKMDQGGGGNEVDNGTPPYWQK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10236

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010236    From 1 To 54 E-value: 2e-27 Score: 113
        FFRHIKSFWKGAKAIFRGARQGWREHRALSKQRKMDQGGGGNEVDNGTPPYWQK
  • 2. L12A07790|    From 23 To 70 E-value: 0.00000002 Score: 49.7
        FFRHL---FRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDN---NQEEPYNQR
  • 3. L12A01717|    From 1 To 22 E-value: 0.0000002 Score: 46.2
        FFRHIKSFWKGAKAIFRGARQG
  • 4. L02A001377    From 1 To 39 E-value: 0.0000002 Score: 46.2
        FFRHL---FRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDN
  • 5. L12A07791|    From 24 To 52 E-value: 0.0000004 Score: 45.4
        IGSLFRGAKAIFRGARQGWRSHKAVSRYR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhuang ZR, Yang XD, Huang XZ, Gu HX, Wei HY, He YJ, Deng L
  •   Title:Three new piscidins from orange-spotted grouper (Epinephelus coioides): Phylogeny, expression and functional characterization
  •   Journal:Fish Shellfish Immunol, 2017, 66, 240-253  [:28433718]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: