Record in detail


General Info

  • lamp_id:L11A010351
  • Name:ApCec, Ap Cecropin
  • FullName:
  • Source: Antheraea pernyi
  • Mass:4109.9 Da
  • Sequence Length:38 aa
  • Isoelectric Point:11.42
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        KWKFFKKIERVGQNIRDGIIKAGPAVAVVGQATNIAKG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10351

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010351    From 1 To 38 E-value: 4e-16 Score: 75.5
        KWKFFKKIERVGQNIRDGIIKAGPAVAVVGQATNIAKG
  • 2. L03A000212    From 27 To 64 E-value: 0.000000000000007 Score: 70.9
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKG
  • 3. L07APD0027    From 1 To 38 E-value: 0.00000000000001 Score: 70.1
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKG
  • 4. L01A000062    From 1 To 37 E-value: 0.00000000000004 Score: 68.2
        KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
  • 5. L11A013148    From 1 To 38 E-value: 0.00000000000007 Score: 67.8
        KWKFFKKIERVGQNIRDGIIKAGPAVQVVGQAATIYKG

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Fang SL, Wang L, Fang Q, Chen C, Zhao XS, Qian CD, Wei GQ, Zhu BJ, Liu CL
  •   Title:Characterization and functional study of a Cecropin-like peptide from the Chinese oak silkworm, Antheraea pernyi
  •   Journal:Arch Insect Biochem Physiol, 2017, 94  [:28008655]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: