Record in detail


General Info

  • lamp_id:L11A010399
  • Name:Cecropin-D-like peptide [E1,6,8R;Q12K;D16K]
  • FullName:
  • Source:
  • Mass:4350.1 Da
  • Sequence Length:39 aa
  • Isoelectric Point:12.53
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        RNFFKRIRRAGKRIRKAIISAAPAVETLAQAQKIIKGGD
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10399

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010399    From 1 To 39 E-value: 3e-16 Score: 75.5
        RNFFKRIRRAGKRIRKAIISAAPAVETLAQAQKIIKGGD
  • 2. L11A010398    From 2 To 39 E-value: 0.000000000000003 Score: 72.4
        NFFKRIRRAGKRIRDAIISAAPAVETLAQAQKIIKGGD
  • 3. L01A000175    From 1 To 39 E-value: 0.00000000000004 Score: 68.6
        ENFFKEIERAGQRIRDAIISAAPAVETLAQAQKIIKGGD
  • 4. L11A009761    From 2 To 39 E-value: 0.0000000002 Score: 56.2
        NFFKEKERKGQRIRDAIISRRPRVETLAQAQKIIKGGD
  • 5. L12A07817|    From 26 To 61 E-value: 0.00000008 Score: 47.8
        NPFKELEKAGQRVRDAIISAAPAVEVVGQASSILKG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Onate-Garzon J, Manrique-Moreno M, Trier S, Leidy C, Torres R, Patino E
  •   Title:Antimicrobial activity and interactions of cationic peptides derived from Galleria mellonella cecropin D-like peptide with model membranes
  •   Journal:J Antibiot (Tokyo), 2017, 70, 238-245  [:27999446]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: