Record in detail


General Info

  • lamp_id:L11A010684
  • Name:Class I defensin, NaD2
  • FullName:
  • Source: Nicotiana alata
  • Mass:5263.9 Da
  • Sequence Length:47 aa
  • Isoelectric Point:8.61
  • Activity:CancerFungus
  • Sequence
        RTCESQSHRFKGPCARDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10684

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06371|    From 32 To 78 E-value: 2e-22 Score: 95.9
        RTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC
  • 2. L11A010684    From 1 To 47 E-value: 7e-22 Score: 94.4
        RTCESQSHRFKGPCARDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC
  • 3. L02A001330    From 1 To 47 E-value: 5e-17 Score: 78.2
        RTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGFRRRCFCTKHC
  • 4. L02A000720    From 1 To 47 E-value: 6e-17 Score: 77.8
        RHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC
  • 5. L03A000162    From 31 To 77 E-value: 9e-17 Score: 77.4
        RTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Dracatos PM, van der Weerden nL, Carroll KT, Johnson ED, Plummer KM, Anderson MA
  •   Title:Inhibition of cereal rust fungi by both class I and II defensins derived from the flowers of nicotiana alata
  •   Journal:Mol Plant Pathol, 2014, 15, 67-79  [:24015961]
  •   [2]  Bleackley MR, Payne JA, Hayes BM, Durek T, Craik DJ, Shafee TM, Poon IK, Hulett MD, van der Weerden
  •   Title:nicotiana alata Defensin Chimeras Reveal Differences in the Mechanism of Fungal and Tumor Cell Killing and an Enhanced Antifungal Variant
  •   Journal:Antimicrob Agents Chemother, 2016, 60, 6302-6312  [:27503651]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: