Record in detail


General Info

  • lamp_id:L11A010719
  • Name:Hl Defensin-1, HlDFS1
  • FullName:
  • Source:
  • Mass:4311 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.9
  • Activity:Gram+Gram-CancerFungusMammalian Cell
  • Sequence
        GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10719

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010719    From 1 To 37 E-value: 0.000000000000001 Score: 73.2
        GFGCPFNARRCHRHCRSIRRRAGYCAGRLRLTCTCVR
  • 2. L01A000718    From 1 To 37 E-value: 0.00000000002 Score: 59.3
        GFGCPFNQGACHRHCRSIRRRGGYCAGLIKQTCTCYR
  • 3. L01A000594    From 1 To 37 E-value: 0.00000000004 Score: 58.5
        GFGCPFNQGACHRHCRSIRRRGGYCAGLFKQTCTCYR
  • 4. L02A000539    From 1 To 37 E-value: 0.0000000001 Score: 57
        GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYR
  • 5. L12A01314|    From 14 To 50 E-value: 0.0000000001 Score: 56.6
        GFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCYR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sun T, Pan W, Song Y, Zhang J, Wang J, Dai J
  •   Title:Functional characterization of two defensins, HlDFS1 and HlDFS2, from the hard tick Haemaphysalis longicornis
  •   Journal:Parasit Vectors, 2017, 10, 455  [:28969703]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: