Record in detail


General Info

  • lamp_id:L11A010757
  • Name:Enterocin K1, EntK1
  • FullName:
  • Source: Enterococcus faecium
  • Mass:4564.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.24
  • Activity:Gram+
  • Sequence
        MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10757

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010757    From 1 To 37 E-value: 8e-18 Score: 80.9
        MKFKFNPTGTIVKKLTQYEIAWFKNKHGYYPWEIPRC
  • 2. L01A002788    From 11 To 42 E-value: 0.0001 Score: 37.4
        KFPNPYTLAAKLTTYEINWYKQQYGRYPWERP
  • 3. L13A019481    From 3 To 26 E-value: 0.089 Score: 27.3
        TILRFVAGYDIASHKKKTGGYPWE

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ovchinnikov KV, Kristiansen PE, Straume D, Jensen MS, Aleksandrzak-Piekarczyk T, nes IF, Diep DB
  •   Title:The Leaderless Bacteriocin Enterocin K1 Is Highly Potent against Enterococcus faecium: A Study on Structure, Target Spectrum and Receptor
  •   Journal:Front Microbiol, 2017, 8, 774  [:28515717]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: