Record in detail


General Info

  • lamp_id:L11A010760
  • Name:Moricin PxMor3
  • FullName:
  • Source: Plutella xylostella
  • Mass:4374.1 Da
  • Sequence Length:42 aa
  • Isoelectric Point:11.36
  • Activity:Gram+Gram-
  • Sequence
        APKVNVNALKKGGHVIKKGLGVIGAAGTAHEVYNHVRNRNQG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10760

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010760    From 1 To 42 E-value: 2e-18 Score: 82.4
        APKVNVNALKKGGHVIKKGLGVIGAAGTAHEVYNHVRNRNQG
  • 2. L12A09019|    From 24 To 65 E-value: 1e-17 Score: 80.1
        APKVNVNALKKGGRVIKKGLGVIGAAGTAHEVYNHVRNRNQG
  • 3. L11A010759    From 1 To 42 E-value: 4e-17 Score: 78.6
        APKVNVNALRKGGRVIRKGLGVIGAAGTAHEVYNHVRNRNQG
  • 4. L01A000164    From 1 To 38 E-value: 0.00000000009 Score: 57.4
        KVPVGAIKKGGKAIKTGLGVVGAAGTAHEVYSHIRNRH
  • 5. L12A07994|    From 28 To 63 E-value: 0.000000005 Score: 51.6
        KISAIRKGGRVIKKGLGAIGAIGTGHEVYEHFKNRR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Xia XF, Li Y, Yu XQ, Lin JH, Li SY, Li Q, You MS
  •   Title:Cloning and functional identification of moricins from the diamondback moth, Plutella xylostella (L
  •   Journal:Insect Mol Biol, 2017, 26, 564-573  [:28621439]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: