Record in detail


General Info

  • lamp_id:L11A010791
  • Name:Pc-arasin1
  • FullName:
  • Source: Procambarus clarkii
  • Mass:4629.4 Da
  • Sequence Length:42 aa
  • Isoelectric Point:8.68
  • Activity:Gram+Gram-
  • Sequence
        LPLNTIPRPPYFPGKLPPRGGHLFPPTCVCVRSPCPCDQNWG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10791

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010791    From 1 To 42 E-value: 2e-19 Score: 86.3
        LPLNTIPRPPYFPGKLPPRGGHLFPPTCVCVRSPCPCDQNWG
  • 2. L11A010792    From 1 To 37 E-value: 0.009 Score: 30.8
        LPLSINPWRPPFPGR-PLPGGPLVLPGCVCVRAPCYCS
  • 3. L02A001757    From 26 To 41 E-value: 0.14 Score: 26.9
        PGCVCIRSPCPC-ANYG
  • 4. L02A000988    From 8 To 35 E-value: 0.44 Score: 25
        RPRPFPGRPNP---IFRPRPCICVRQPCPCD
  • 5. L02A001660    From 18 To 31 E-value: 1.3 Score: 23.5
        PGCVCFRAPCPCSN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chai LQ, Li WW, Wang XW
  •   Title:Identification and characterization of two arasin-like peptides in red swamp crayfish Procambarus clarkii
  •   Journal:Fish Shellfish Immunol, 2017, 70, 673-681  [:28951220]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: