Record in detail


General Info

  • lamp_id:L11A010792
  • Name:Pc-arasin2
  • FullName:
  • Source: Procambarus clarkii
  • Mass:5520.4 Da
  • Sequence Length:50 aa
  • Isoelectric Point:8.67
  • Activity:Gram+Gram-
  • Sequence
        LPLSINPWRPPFPGRPLPGGPLVLPGCVCVRAPCYCSPSRQKDFPGFEHY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10792

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010792    From 1 To 50 E-value: 6e-24 Score: 101
        LPLSINPWRPPFPGRPLPGGPLVLPGCVCVRAPCYCSPSRQKDFPGFEHY
  • 2. L11A010791    From 1 To 38 E-value: 0.01 Score: 30.8
        LPLNTIPRPPYFPGKLPPRGGHLFPPTCVCVRSPCPCD
  • 3. L02A001757    From 11 To 38 E-value: 0.012 Score: 30.4
        PFGGRPFVGGQFGGRPGCVCIRSPCPCA
  • 4. L02A001660    From 11 To 30 E-value: 0.54 Score: 25
        RPPVVGRP---------GCVCFRAPCPCS
  • 5. L02A000988    From 11 To 35 E-value: 0.9 Score: 24.3
        PFPGRP---NPIFRPRPCICVRQPCPCD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Chai LQ, Li WW, Wang XW
  •   Title:Identification and characterization of two arasin-like peptides in red swamp crayfish Procambarus clarkii
  •   Journal:Fish Shellfish Immunol, 2017, 70, 673-681  [:28951220]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: