Record in detail


General Info

  • lamp_id:L11A010933
  • Name:Alpha-S2-casein (164-207)
  • FullName:
  • Source:
  • Mass:5451.6 Da
  • Sequence Length:44 aa
  • Isoelectric Point:10.93
  • Activity:Gram+Gram-
  • Sequence
        LKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  10933

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A010933    From 1 To 44 E-value: 9e-20 Score: 87.4
        LKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL
  • 2. L11A008380    From 1 To 26 E-value: 0.0000000004 Score: 55.1
        TVYQHQKAMKPWIQPKTKVIPYVRYL
  • 3. L11A007503    From 1 To 25 E-value: 0.000000002 Score: 53.1
        VYQHQKAMKPWIQPKTKVIPYVRYL
  • 4. L01A002828    From 15 To 39 E-value: 0.000000005 Score: 51.6
        LKKISQRYQKFALPQYLKTVYQHQK
  • 5. L11A007504    From 1 To 20 E-value: 0.000002 Score: 43.1
        KAMKPWIQPKTKVIPYVRYL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Adoui F, Boughera F, Chataigne G, Chihib nE, El Hameur H, Dhulster P, Zidoune Mn, nedjar-Arroume n
  •   Title:A Simple Method to Separate the Antimicrobial Peptides from Complex Peptic Casein Hydrolysate and Identification of a novel Antibacterial Domains within the Sequence of Bovine ?s-Casein
  •   Journal:IRECHE, 2013, 5, 179-187  [:]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: