Record in detail


General Info

  • lamp_id:L11A011161
  • Name:AvBD-12 [C5,34Abu]
  • FullName:
  • Source:
  • Mass:4806.4 Da
  • Sequence Length:45 aa
  • Isoelectric Point:7.93
  • Activity:Gram+Gram-
  • Sequence
        GPDSXNHDRGLCRVGNCNPGEYLAKYCFEPVILXCKPLSPTPTKT
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11161

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011161    From 1 To 45 E-value: 8e-21 Score: 90.5
        GPDSXNHDRGLCRVGNCNPGEYLAKYCFEPVILXCKPLSPTPTKT
  • 2. L02A001324    From 1 To 45 E-value: 2e-20 Score: 89.7
        GPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
  • 3. L01A003416    From 2 To 46 E-value: 2e-20 Score: 89.7
        GPDSCNHDRGLCRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
  • 4. L05ADEF301    From 21 To 65 E-value: 6e-20 Score: 87.8
        GPDSCNHDRGLSRVGNCNPGEYLAKYCFEPVILCCKPLSPTPTKT
  • 5. L11A011162    From 1 To 45 E-value: 3e-19 Score: 85.1
        GPDSXNHDRGLXRVGNCNPGEYLAKYXFEPVILXCKPLSPTPTKT

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yang M, Zhang C, Zhang MZ, Zhang S
  •   Title:novel synthetic analogues of avian ?-defensin-12: the role of charge, hydrophobicity, and disulfide bridges in biological functions
  •   Journal:BMC Microbiol, 2017, 17, 43  [:28231771]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: