Record in detail


General Info

  • lamp_id:L11A011326
  • Name:Antibacterial peptide MeuNaTx-15, MTbeta-2
  • FullName:
  • Source: Mesobuthus eupeus
  • Mass:7435.3 Da
  • Sequence Length:64 aa
  • Isoelectric Point:7.65
  • Activity:Gram+Gram-
  • Sequence
        DNGYLLDKYTGCKIWCVINNDSCNSHCIGSGGYYGYCYFWKLACYCQGAPRSELWHYETNRCRA
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11326

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011326    From 1 To 64 E-value: 1e-33 Score: 133
        DNGYLLDKYTGCKIWCVINNDSCNSHCIGSGGYYGYCYFWKLACYCQGAPRSELWHYETNRCRA
  • 2. L12A01148|    From 1 To 62 E-value: 1e-26 Score: 110
        DNGYLLDKYTGCKVWCVINNESCNSECKIRRGNYGYCYFWKLACYCEGAPKSELWHYETNKC
  • 3. L11A011327    From 1 To 62 E-value: 4e-26 Score: 108
        EHGYLLDKYTGCKVWCVINNESCNGECKRRGGYYGYCYFWKLACFCQGARKSELWHYETNKC
  • 4. L07APD0132    From 1 To 64 E-value: 4e-26 Score: 108
        DNGYLLDKYTGCKVWCVINNESCNSECKIRGGYYGYCYFWKLACFCQGARKSELWNYNTNKCNG
  • 5. L13A017036    From 1 To 50 E-value: 1e-19 Score: 87
        DNGYLLDKYTGCKVWCVINNESCNSECKIRRGNYGYCYFWKLACYCEGAP

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Moosazadeh Moghaddam M, Eftekhary M, Erfanimanesh S, Hashemi A, Fallah Omrani V, Farhadihosseinabadi
  •   Title:Comparison of the antibacterial effects of a short cationic peptide and 1% silver bioactive glass against extensively drug-resistant bacteria, Pseudomonas aeruginosa and Acinetobacter baumannii, isolated from burn patients
  •   Journal:Amino Acids, 2018  [:30145712]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: