Record in detail


General Info

  • lamp_id:L11A011406
  • Name:A-LL-37 (2-31)-Histatin-5 (4-15)-LEY
  • FullName:
  • Source:
  • Mass:5733.7 Da
  • Sequence Length:46 aa
  • Isoelectric Point:11.29
  • Activity:Gram+Gram-FungusMammalian Cell
  • Sequence
        ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLAKRHHGYKRKFHLEY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11406

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011406    From 1 To 46 E-value: 7e-21 Score: 90.9
        ALGDFFRKSKEKIGKEFKRIVQRIKDFLRNLAKRHHGYKRKFHLEY
  • 2. L11A011405    From 1 To 42 E-value: 2e-18 Score: 82.8
        LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLAKRHHGYKRKFH
  • 3. L12A11486|    From 23 To 58 E-value: 0.000000000002 Score: 62.8
        LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 4. L11A011557    From 2 To 37 E-value: 0.000000000002 Score: 62.8
        LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 5. L11A011556    From 2 To 37 E-value: 0.000000000002 Score: 62.8
        LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wanmakok M, Orrapin S, Intorasoot A, Intorasoot S
  •   Title:Expression in Escherichia coli of novel recombinant hybrid antimicrobial peptide AL32-P113 with enhanced antimicrobial activity in vitro
  •   Journal:Gene, 2018  [:29859288]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: