Record in detail


General Info

  • lamp_id:L11A011467
  • Name:Sublancin
  • FullName:
  • Source:
  • Mass:3674.2 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.68
  • Activity:Gram+Gram-CancerMammalian Cell
  • Sequence
        GLGKAQCAALWLQCASGGTIGXGGGAVACQNYRQFCR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11467

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011467    From 1 To 37 E-value: 0.000000000000006 Score: 71.2
        GLGKAQCAALWLQCASGGTIGXGGGAVACQNYRQFCR
  • 2. L12A06744|    From 20 To 56 E-value: 0.00000000008 Score: 57.4
        GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR
  • 3. L02A001606    From 1 To 37 E-value: 0.0000000003 Score: 55.5
        GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR
  • 4. L13A012330    From 1 To 18 E-value: 0.0002 Score: 36.6
        IGCGGGAVACQNYRQFCR
  • 5. L13A022502    From 1 To 39 E-value: 4.9 Score: 21.6
        GIGTAQCAYFKALCYSGGSEWLGGYGGCGSTQNNCELAR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Wang S, Wang Q, Zeng X, Ye Q, Huang S, Yu H, Yang T, Qiao S
  •   Title:Use of the Antimicrobial Peptide Sublancin with Combined Antibacterial and Immunomodulatory Activities To Protect against Methicillin-Resistant Staphylococcus aureus Infection in Mice
  •   Journal:J Agric Food Chem, 2017, 65, 8595-8605  [:28906115]
  •   [2]  Paik SH, Chakicherla A, Hansen Jn
  •   Title: the chemical and biological properties of, sublancin 168, a novel lantibiotic produced by Bacillus subtilis 168
  •   Journal:J Biol Chem, 1998, 273, 23134-23142  [:9722542]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: