Record in detail


General Info

  • lamp_id:L11A011540
  • Name:Triintsin, Trichophyton Defensin
  • FullName:
  • Source: Trichophyton interdigitale Trichophyton mentagrophytes
  • Mass:4161.8 Da
  • Sequence Length:38 aa
  • Isoelectric Point:8.13
  • Activity:Gram+Gram-FungusMammalian Cell
  • Sequence
        GFGCPLNERECHSHCQSIGRKFGYCGGTLRLTCICGKE
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11540

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011540    From 1 To 38 E-value: 3e-17 Score: 79
        GFGCPLNERECHSHCQSIGRKFGYCGGTLRLTCICGKE
  • 2. L13A011529    From 1 To 38 E-value: 0.000000000001 Score: 63.2
        GFGCPFNENECHAHCLSIGRKFGFCAGPLRATCTCGKQ
  • 3. L11A009815    From 1 To 38 E-value: 0.000000000003 Score: 62.4
        GFGCPFNQNECHAHCLSIGRKFGFCAGPLRATCTCGKQ
  • 4. L11A009813    From 1 To 38 E-value: 0.000000000004 Score: 62
        GFGCPFNKNECHAHCLSIGRKFGFCAGPLRATCTCGKQ
  • 5. L11A009812    From 1 To 38 E-value: 0.000000000004 Score: 61.6
        GFGCPFNANECHAHCLSIGRKFGFCAGPLRATCTCGKQ

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Shen B, Song J, Zhao Y, Zhang Y, Liu G, Li X, Guo X, Li W, Cao Z, Wu Y
  •   Title:Triintsin, a human pathogenic fungus-derived defensin with broad-spectrum antimicrobial activity
  •   Journal:Peptides, 2018  [:30102941]
  •   [2]  Yang n, Teng D, Mao R, Hao Y, Wang X, Wang Z, Wang J
  •   Title:A recombinant fungal defensin-like peptide-P2 combats multidrug-resistant Staphylococcus aureus and biofilms
  •   Journal:Appl Microbiol Biotechnol, 2019  [:31025073]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: