Record in detail


General Info

  • lamp_id:L11A011555
  • Name:FgAFP
  • FullName:
  • Source:
  • Mass:6357.2 Da
  • Sequence Length:55 aa
  • Isoelectric Point:9.08
  • Activity:Fungus
  • Sequence
        LEYWGKCTKAENRCKYKNDKGKDVLQNCPKFDNKKCTKDGNSCKWDSASKALTCY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11555

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011555    From 1 To 55 E-value: 7e-27 Score: 110
        LEYWGKCTKAENRCKYKNDKGKDVLQNCPKFDNKKCTKDGNSCKWDSASKALTCY
  • 2. L02A001560    From 2 To 54 E-value: 0.00000000000008 Score: 67.4
        KYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDC
  • 3. L11A012491    From 2 To 54 E-value: 0.000000000001 Score: 63.9
        KYTGKCYKKKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDC
  • 4. L12A05713|    From 1 To 53 E-value: 0.00000002 Score: 49.3
        LEYKGECFTKDNTCKYKID-GKTYLAKCPSAANTKCEKDGNKCTYDSYNRKVKC
  • 5. L11A012492    From 19 To 54 E-value: 0.0000008 Score: 44.3
        DAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Patino B, V¨¢zquez C, Manning JM, Roncero MIG, Cordoba-Canero D, Di Pietro A, Martinez-Del-Pozo ¨¢
  •   Title:Characterization of a novel cysteine-rich antifungal protein from Fusarium graminearum with activity against maize fungal pathogens
  •   Journal:Int J Food Microbiol, 2018, 283, 45-51  [:30099994]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: