Record in detail
General Info
- lamp_id:L11A011782
- Name:CAP18 [I13H]
- FullName:
- Source:
- Mass:4457.4 Da
- Sequence Length:37 aa
- Isoelectric Point:12.11
- Activity:Gram+Gram-Mammalian Cell
- Sequence
GLRKRLRKFRNKHKEKLKKIGQKIQGLLPKLAPRTDY - Function:
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 11782
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L11A011782 From 1 To 37 E-value: 0.000000000000002 Score: 72.4
GLRKRLRKFRNKHKEKLKKIGQKIQGLLPKLAPRTDY - 2. L11A013078 From 1 To 37 E-value: 0.00000000000001 Score: 70.1
GLRKRLRKFRNKNKEKLKKIGQKIQGLLPKLAPRTDY - 3. L11A013080 From 1 To 37 E-value: 0.00000000000001 Score: 70.1
GLRKRLRKFRNKSKEKLKKIGQKIQGLLPKLAPRTDY - 4. L11A013079 From 1 To 37 E-value: 0.00000000000001 Score: 70.1
GLRKRLRKFRNKQKEKLKKIGQKIQGLLPKLAPRTDY - 5. L11A011783 From 1 To 37 E-value: 0.00000000000002 Score: 69.7
GLRKRLRKFRNKMKEKLKKIGQKIQGLLPKLAPRTDY
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Ebbensgaard A, Mordhorst H, Aarestrup FM, Hansen EB
- Title:The Role of Outer Membrane Proteins and Lipopolysaccharides for the Sensitivity of Escherichia coli to Antimicrobial Peptides
- Journal:Front Microbiol, 2018, 9, 2153 [:30245684]
- [2] Ebbensgaard A, Mordhorst H, Overgaard MT, Aarestrup FM, Hansen EB
- Title:Dissection of the antimicrobial and hemolytic activity of Cap18: Generation of Cap18 derivatives with enhanced specificity
- Journal:PLoS One, 2018, 13, e0197742 [:29852015]
Comments
- Comments
No comments found on LAMP database