Record in detail
General Info
- lamp_id:L11A011802
- Name:CAP18 [L27P]
- FullName:
- Source:
- Mass:4417.4 Da
- Sequence Length:37 aa
- Isoelectric Point:12.11
- Activity:Gram+Gram-Mammalian Cell
- Sequence
GLRKRLRKFRNKIKEKLKKIGQKIQGPLPKLAPRTDY - Function:
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 11802
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L11A011802 From 1 To 37 E-value: 0.000000000000004 Score: 72
GLRKRLRKFRNKIKEKLKKIGQKIQGPLPKLAPRTDY - 2. L01A000997 From 1 To 37 E-value: 0.00000000000004 Score: 68.6
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY - 3. L11A011783 From 1 To 37 E-value: 0.00000000000007 Score: 67.8
GLRKRLRKFRNKMKEKLKKIGQKIQGLLPKLAPRTDY - 4. L01A003962 From 1 To 37 E-value: 0.00000000000008 Score: 67.4
GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY - 5. L11A013098 From 1 To 37 E-value: 0.0000000000001 Score: 67
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKCAPRTDY
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Ebbensgaard A, Mordhorst H, Aarestrup FM, Hansen EB
- Title:The Role of Outer Membrane Proteins and Lipopolysaccharides for the Sensitivity of Escherichia coli to Antimicrobial Peptides
- Journal:Front Microbiol, 2018, 9, 2153 [:30245684]
- [2] Ebbensgaard A, Mordhorst H, Overgaard MT, Aarestrup FM, Hansen EB
- Title:Dissection of the antimicrobial and hemolytic activity of Cap18: Generation of Cap18 derivatives with enhanced specificity
- Journal:PLoS One, 2018, 13, e0197742 [:29852015]
Comments
- Comments
No comments found on LAMP database