Record in detail


General Info

  • lamp_id:L11A011802
  • Name:CAP18 [L27P]
  • FullName:
  • Source:
  • Mass:4417.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:12.11
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        GLRKRLRKFRNKIKEKLKKIGQKIQGPLPKLAPRTDY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11802

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011802    From 1 To 37 E-value: 0.000000000000004 Score: 72
        GLRKRLRKFRNKIKEKLKKIGQKIQGPLPKLAPRTDY
  • 2. L01A000997    From 1 To 37 E-value: 0.00000000000004 Score: 68.6
        GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
  • 3. L11A011783    From 1 To 37 E-value: 0.00000000000007 Score: 67.8
        GLRKRLRKFRNKMKEKLKKIGQKIQGLLPKLAPRTDY
  • 4. L01A003962    From 1 To 37 E-value: 0.00000000000008 Score: 67.4
        GLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY
  • 5. L11A013098    From 1 To 37 E-value: 0.0000000000001 Score: 67
        GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKCAPRTDY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ebbensgaard A, Mordhorst H, Aarestrup FM, Hansen EB
  •   Title:The Role of Outer Membrane Proteins and Lipopolysaccharides for the Sensitivity of Escherichia coli to Antimicrobial Peptides
  •   Journal:Front Microbiol, 2018, 9, 2153  [:30245684]
  •   [2]  Ebbensgaard A, Mordhorst H, Overgaard MT, Aarestrup FM, Hansen EB
  •   Title:Dissection of the antimicrobial and hemolytic activity of Cap18: Generation of Cap18 derivatives with enhanced specificity
  •   Journal:PLoS One, 2018, 13, e0197742  [:29852015]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: