Record in detail


General Info

  • lamp_id:L11A011818
  • Name:Sushi 1 [K3,5G;M7L;S11L;P14G;G16R;P22F;P23K;C25L;I26N;E28K;S33,34K], SRP-1
  • FullName:
  • Source:
  • Mass:3855.7 Da
  • Sequence Length:34 aa
  • Isoelectric Point:11.78
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        GFGLGGLARILCLGNRQWSNFFKKLNRKCAMVKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11818

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011818    From 1 To 34 E-value: 0.00000000000003 Score: 69.3
        GFGLGGLARILCLGNRQWSNFFKKLNRKCAMVKK
  • 2. L02A001623    From 1 To 32 E-value: 0.000001 Score: 43.9
        GFKLKGMARISCLPNGQWSNFPPKCIRECAMV
  • 3. L11A011819    From 1 To 34 E-value: 0.000002 Score: 43.1
        GFALAGLARILCLWFREFSGFFRRLNRRFAMRRR
  • 4. L13A025464    From 1 To 32 E-value: 0.000008 Score: 40.8
        GFKLKGKAKISCLPNGQWSNFPPKCIRECAMV
  • 5. L11A011820    From 1 To 34 E-value: 0.0001 Score: 37
        GAALAGLAKILCLWAKEFTGAFKKLNKKFAMKKK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Yang CH, Chen YC, Peng SY, Tsai AP, Lee TJ, Yen JH, Liou JW
  •   Title:An engineered arginine-rich ?-helical antimicrobial peptide exhibits broad-spectrum bactericidal activity against pathogenic bacteria and reduces bacterial infections in mice
  •   Journal:Sci Rep, 2018, 8, 14602  [:30279591]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: