Record in detail


General Info

  • lamp_id:L11A011841
  • Name:Recombinant Paracentrin, RP1
  • FullName:
  • Source:
  • Mass:3720 Da
  • Sequence Length:33 aa
  • Isoelectric Point:7.97
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        MSGSHHHHHHGSSGENLYFQSLEVASFDKSKLK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11841

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011841    From 1 To 33 E-value: 0.0000000000002 Score: 65.9
        MSGSHHHHHHGSSGENLYFQSLEVASFDKSKLK
  • 2. L13A021327    From 1 To 11 E-value: 0.73 Score: 24.3
        EVASFDKSKLK
  • 3. L13A025874    From 8 To 18 E-value: 2.5 Score: 22.7
        EVESFDKSKLK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Spinello A, Cusimano MG, Schillaci D, Inguglia L, Barone G, Arizza V
  •   Title:Antimicrobial and Antibiofilm Activity of a Recombinant Fragment of ?-Thymosin of Sea Urchin Paracentrotus lividus
  •   Journal:Mar Drugs, 2018, 16, E366  [:30279359]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: