Record in detail


General Info

  • lamp_id:L11A011937
  • Name:Antifungal protein Afp [G29P,S30W,A31F,A32W,K34INS], dAfpB9
  • FullName:
  • Source:
  • Mass:7034 Da
  • Sequence Length:59 aa
  • Isoelectric Point:9.12
  • Activity:Fungus
  • Sequence
        LSKYGGQCSLKHNTCTYLKGGRNVIVNCPWFWNKKRCKSDRHHCEYDEHHRRVDCQTPV
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  11937

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011937    From 1 To 59 E-value: 2e-31 Score: 125
        LSKYGGQCSLKHNTCTYLKGGRNVIVNCPWFWNKKRCKSDRHHCEYDEHHRRVDCQTPV
  • 2. L11A011936    From 1 To 58 E-value: 3e-26 Score: 108
        LSKYGGQCSLKHNTCTYLKGGRNVIVNCGSAAN-KRCKSDRHHCEYDEHHRRVDCQTPV
  • 3. L12A08940|    From 35 To 92 E-value: 1e-24 Score: 103
        LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKK-CKSDRHHCEYDEHHKRVDCQTPV
  • 4. L02A001562    From 1 To 58 E-value: 1e-23 Score: 100
        LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKK-CKSDRHHCEYDEHHKRVDCQTPV
  • 5. L11A006646    From 1 To 58 E-value: 1e-21 Score: 93.2
        LSKYGGECSVEHNTCTYLKGGKDHIVSCPSAAN-LRCKTERHHCEYDEHHKTVDCQTPV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Heredero M, Garrigues S, Gandia M, Marcos JF, Manzanares P
  •   Title:Rational Design and Biotechnological Production of novel AfpB-PAF26 Chimeric Antifungal Proteins
  •   Journal:Microorganisms, 2018, 6, E106  [:30326659]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: