Record in detail


General Info

  • lamp_id:L11A012112
  • Name:Dermaseptin-PS1, Dermaseptin cDNA
  • FullName:
  • Source: Phyllomedusa sauvagei
  • Mass:3164.8 Da
  • Sequence Length:31 aa
  • Isoelectric Point:10.8
  • Activity:Gram+Gram-CancerFungus
  • Sequence
        ALWKTMLKKLGTVALHAGKAALGAVADTISQ
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12112

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A012112    From 1 To 31 E-value: 0.00000000001 Score: 60.1
        ALWKTMLKKLGTVALHAGKAALGAVADTISQ
  • 2. L12A06611|    From 45 To 75 E-value: 0.0000000002 Score: 56.2
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 3. L12A06182|    From 45 To 75 E-value: 0.0000000002 Score: 56.2
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 4. L02A000956    From 1 To 31 E-value: 0.0000000003 Score: 55.5
        ALWKDVLKKIGTVALHAGKAALGAVADTISQ
  • 5. L01A000215    From 1 To 31 E-value: 0.0000000005 Score: 54.7
        AMWKDVLKKIGTVALHAGKAALGAVADTISQ

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Long Q, Li L, Wang H, Li M, Wang L, Zhou M, Su Q, Chen T, Wu Y
  •   Title:novel peptide dermaseptin-PS1 exhibits anticancer activity via induction of intrinsic apoptosis signalling
  •   Journal:J Cell Mol Med, 2018  [:30461197]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: