Record in detail


General Info

  • lamp_id:L11A012115
  • Name:Plectasin [D9S,M13L,Q14R,N17R,K26R], AP138
  • FullName:
  • Source:
  • Mass:4460.1 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.61
  • Activity:Gram+
  • Sequence
        GFGCNGPWSEDDLRCHRHCKSIKGYRGGYCAKGGFVCKCY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12115

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A012115    From 1 To 40 E-value: 1e-18 Score: 83.6
        GFGCNGPWSEDDLRCHRHCKSIKGYRGGYCAKGGFVCKCY
  • 2. L12A08934|    From 56 To 95 E-value: 3e-18 Score: 82
        GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 3. L13A011186    From 3 To 42 E-value: 2e-17 Score: 79.7
        GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 4. L11A004535    From 1 To 40 E-value: 2e-17 Score: 79.7
        GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY
  • 5. L01A003049    From 1 To 40 E-value: 7e-17 Score: 77.8
        GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Groo AC, Matougui n, Umerska A, Saulnier P
  •   Title:Reverse micelle-lipid nanocapsules: a novel strategy for drug delivery of the plectasin derivate AP138 antimicrobial peptide
  •   Journal:Int J nanomedicine, 2018, 13, 7565-7574  [:30532539]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: