Record in detail


General Info

  • lamp_id:L11A012393
  • Name:WAMP-2
  • FullName:
  • Source: Triticum kiharae Triticum aestivum
  • Mass:4658.3 Da
  • Sequence Length:45 aa
  • Isoelectric Point:8.42
  • Activity:Fungus
  • Sequence
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGKGSCQSQCRGCR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12393

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A012393    From 1 To 45 E-value: 2e-19 Score: 85.9
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGKGSCQSQCRGCR
  • 2. L11A012394    From 1 To 45 E-value: 4e-19 Score: 84.7
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGEGSCQSQCRGCR
  • 3. L11A012395    From 1 To 45 E-value: 6e-19 Score: 84.3
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGNGSCQSQCRGCR
  • 4. L02A001470    From 1 To 45 E-value: 7e-19 Score: 84.3
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGCR
  • 5. L01A003802    From 1 To 44 E-value: 3e-18 Score: 82.4
        AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Slavokhotova AA, naumann TA, Price nP, Rogozhin EA, Andreev YA, Vassilevski AA, Odintsova TI
  •   Title:novel mode of action of plant defense peptides - hevein-like antimicrobial peptides from wheat inhibit fungal metalloproteases
  •   Journal:FEBS J, 2014, 280, 4754-4764  [:25154438]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: