Record in detail


General Info

  • lamp_id:L11A012438
  • Name:Myticin C, Myticin C (1-40)
  • FullName:
  • Source: Mytilus galloprovincialis
  • Mass:4377.1 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.2
  • Activity:Gram+Gram-Fungus
  • Sequence
        QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12438

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A04745|    From 17 To 56 E-value: 2e-18 Score: 82.4
        QSVACTSYYCSKFCGSAGCSLYGCYKLHPGKICYCLHCSR
  • 2. L12A07675|    From 21 To 60 E-value: 7e-18 Score: 80.9
        QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCRR
  • 3. L02A001788    From 4 To 43 E-value: 1e-17 Score: 80.1
        QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
  • 4. L11A012438    From 1 To 40 E-value: 2e-17 Score: 79.7
        QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR
  • 5. L12A07623|    From 21 To 60 E-value: 3e-16 Score: 75.5
        QSASCTSYYCSKFCGTAGCSLYGCYNLTPGKICYCLHCSR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Domeneghetti S, Franzoi M, Damiano n, norante R, El Halfawy nM, Mammi S, Marin O, Bellanda M, Venier
  •   Title:Structural and Antimicrobial Features of Peptides Related to Myticin C, a Special Defense Molecule from the Mediterranean Mussel Mytilus galloprovincialis
  •   Journal:J Agric Food Chem, 2015, 63, 9251-9259  [:26444944]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: