Record in detail
General Info
- lamp_id:L11A012438
- Name:Myticin C, Myticin C (1-40)
- FullName:
- Source: Mytilus galloprovincialis
- Mass:4377.1 Da
- Sequence Length:40 aa
- Isoelectric Point:8.2
- Activity:Gram+Gram-Fungus
- Sequence
QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR - Function:
Cross-Linking
- Cross-linking
- 1 Database:DBAASP 12438
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A04745| From 17 To 56 E-value: 2e-18 Score: 82.4
QSVACTSYYCSKFCGSAGCSLYGCYKLHPGKICYCLHCSR - 2. L12A07675| From 21 To 60 E-value: 7e-18 Score: 80.9
QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCRR - 3. L02A001788 From 4 To 43 E-value: 1e-17 Score: 80.1
QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR - 4. L11A012438 From 1 To 40 E-value: 2e-17 Score: 79.7
QSVACTSYYCSKFCGSAGCSLYGCYLLHPGKICYCLHCSR - 5. L12A07623| From 21 To 60 E-value: 3e-16 Score: 75.5
QSASCTSYYCSKFCGTAGCSLYGCYNLTPGKICYCLHCSR
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Domeneghetti S, Franzoi M, Damiano n, norante R, El Halfawy nM, Mammi S, Marin O, Bellanda M, Venier
- Title:Structural and Antimicrobial Features of Peptides Related to Myticin C, a Special Defense Molecule from the Mediterranean Mussel Mytilus galloprovincialis
- Journal:J Agric Food Chem, 2015, 63, 9251-9259 [:26444944]
Comments
- Comments
No comments found on LAMP database