Record in detail


General Info

  • lamp_id:L11A012491
  • Name:PAF [T8Y][S10K]
  • FullName:
  • Source:
  • Mass:6353.2 Da
  • Sequence Length:55 aa
  • Isoelectric Point:9.05
  • Activity:FungusMammalian Cell
  • Sequence
        AKYTGKCYKKKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12491

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A012491    From 1 To 55 E-value: 5e-25 Score: 104
        AKYTGKCYKKKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
  • 2. L02A001560    From 1 To 55 E-value: 8e-24 Score: 100
        AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
  • 3. L11A012492    From 1 To 55 E-value: 9e-17 Score: 77.4
        AKYTGKCKTKKNKCKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
  • 4. L11A011555    From 2 To 54 E-value: 0.000000000001 Score: 63.9
        EYWGKCTKAENRCKYKNDKGKDVLQNCPKFDNKKCTKDGNSCKWDSASKALTC
  • 5. L12A05713|    From 2 To 54 E-value: 0.000000002 Score: 52.8
        EYKGECFTKDNTCKYKID-GKTYLAKCPSAANTKCEKDGNKCTYDSYNRKVKCD

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Sonderegger C, V¨¢radi G, Galgoczy L, Kocsube S, Posch W, Borics A, Dubrac S, Toth GK, Wilflingseder
  •   Title:The Evolutionary Conserved ?-Core Motif Influences the Anti-Candida Activity of the Penicillium chrysogenum Antifungal Protein PAF
  •   Journal:Front Microbiol, 2018, 9, 1655  [:30079061]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: