Record in detail


General Info

  • lamp_id:L11A012528
  • Name:Melittin (12-26)[A4L]-AGP-Thanatin
  • FullName:
  • Source:
  • Mass:4479.4 Da
  • Sequence Length:39 aa
  • Isoelectric Point:12.04
  • Activity:Gram+Gram-CancerMammalian Cell
  • Sequence
        GLPLLISWIKRKRQQAGPGSKKPVPIIYCNRRTGKCQRM
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12528

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A012528    From 1 To 39 E-value: 9e-18 Score: 80.5
        GLPLLISWIKRKRQQAGPGSKKPVPIIYCNRRTGKCQRM
  • 2. L01A000294    From 1 To 21 E-value: 0.0000002 Score: 46.6
        GSKKPVPIIYCNRRTGKCQRM
  • 3. L13A021933    From 1 To 21 E-value: 0.0000004 Score: 45.4
        GSKKPVPIIYCNRRSGKCQRM
  • 4. L11A007137    From 1 To 21 E-value: 0.0000004 Score: 45.1
        GSKKPVPIIYCNRRTAKCQRM
  • 5. L11A007136    From 1 To 21 E-value: 0.0000008 Score: 44.3
        GSKKPVPIIYCQRRTGKCQRM

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Jiang X, Qian K, Liu G, Sun L, Zhou G, Li J, Fang X, Ge H, Lv Z
  •   Title:Design and activity study of a melittin-thanatin hybrid peptide
  •   Journal:AMB Express, 2019, 9, 14  [:30701481]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: