Record in detail


General Info

  • lamp_id:L11A012554
  • Name:Beta-astratide bM1
  • FullName:
  • Source: Huang Qi, Astragalus membranaceus
  • Mass:4734.5 Da
  • Sequence Length:45 aa
  • Isoelectric Point:8.41
  • Activity:Fungus
  • Sequence
        CEKPSKFFSGPCIGSSGKTQCAYLCRRGEGLQDGNCKGLKCVCAC
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12554

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A012554    From 1 To 45 E-value: 8e-21 Score: 90.5
        CEKPSKFFSGPCIGSSGKTQCAYLCRRGEGLQDGNCKGLKCVCAC
  • 2. L05ADEF280    From 32 To 72 E-value: 0.00006 Score: 38.1
        CETSSNLFNGPCLSSS---NCANVC-HNEGFSDGDCRGFRRRCLC
  • 3. L06AT00035    From 3 To 43 E-value: 0.0001 Score: 37
        CETSSNLFNGPCLSSS---NCANVC-HNEGFSDGDCRGFRRRCLC
  • 4. L13A017999    From 1 To 41 E-value: 0.0002 Score: 36.6
        CETPSKHFNGLCIRSS---NCASVC-HGEHFTDGRCQGVRRRCMC
  • 5. L11A012622    From 7 To 47 E-value: 0.0002 Score: 36.2
        CETPSKHFDGLCIRSS---DCASVC-HGEHFTDGRCEGVRRRCMC

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Huang J, Wong KH, Tay SV, Serra A, Sze SK, Tam JP
  •   Title:Astratides: Insulin-Modulating, Insecticidal, and Antifungal Cysteine-Rich Peptides from Astragalus membranaceus
  •   Journal:J nat Prod, 2019  [:30758201]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: