Record in detail


General Info

  • lamp_id:L11A012679
  • Name:FGR (7-22)-HEXIM1 (147-164), FGF-BR
  • FullName:
  • Source:
  • Mass:3852.7 Da
  • Sequence Length:34 aa
  • Isoelectric Point:13
  • Activity:CancerMammalian Cell
  • Sequence
        AAVALLPAVLLALLAPQLGKKKHRRRPSKKKRHW
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  12679

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A012679    From 1 To 34 E-value: 0.0000000000006 Score: 64.7
        AAVALLPAVLLALLAPQLGKKKHRRRPSKKKRHW
  • 2. L11A012680    From 11 To 28 E-value: 0.00004 Score: 38.5
        QLGKKKHRRRPSKKKRHW
  • 3. L11A012676    From 12 To 32 E-value: 0.00005 Score: 38.1
        WGGQLGKKKHRRRPSKKKRHW
  • 4. L11A012674    From 1 To 18 E-value: 0.00006 Score: 38.1
        QLGKKKHRRRPSKKKRHW
  • 5. L11A012686    From 17 To 34 E-value: 0.12 Score: 26.9
        QLGKKILAARPSKKKRHW

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  neo SH, Lew QJ, Koh SM, Zheng L, Bi X, Chao SH
  •   Title:Use of a novel cytotoxic HEXIM1 peptide in the directed breast cancer therapy
  •   Journal:Oncotarget, 2016, 7, 5483-5494  [:26734838]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: