Record in detail


General Info

  • lamp_id:L11A013049
  • Name:Potassium channel toxin MeuTXKalpha3 [P30N]
  • FullName:
  • Source:
  • Mass:4478.2 Da
  • Sequence Length:38 aa
  • Isoelectric Point:9.81
  • Activity:Gram+Gram-
  • Sequence
        VDFPNKGGKCDRKECRKTCKKLNYRGKCFNNYCRCFPG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  13049

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A013049    From 1 To 38 E-value: 1e-16 Score: 77
        VDFPNKGGKCDRKECRKTCKKLNYRGKCFNNYCRCFPG
  • 2. L11A013048    From 1 To 38 E-value: 6e-16 Score: 74.7
        VDFPNKGGKCDRKECRKTCKKLNYRGKCFPNYCRCFPG
  • 3. L11A013050    From 1 To 39 E-value: 0.0000000000002 Score: 66.6
        VDFPNKGGKCDRKECRKTCKKLNYRGKCKFGGICRCFPG
  • 4. L02A000437    From 11 To 37 E-value: 0.17 Score: 26.6
        KECWSVCQRLHNTSRGKCMNKKCRCYS
  • 5. L13A019994    From 11 To 37 E-value: 0.17 Score: 26.6
        KECWSVCQRLHNTSRGKCMNKKCRCYS

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zhang S, Gao B, Wang X, Zhu S
  •   Title:Loop Replacement Enhances the Ancestral Antibacterial Function of a Bifunctional Scorpion Toxin
  •   Journal:Toxins (Basel), 2018, 10  [:29867003]
  •   [2]  Wang X, Gao B, Zhu S
  •   Title:A single-point mutation enhances dual functionality of a scorpion toxin
  •   Journal:Comp Biochem Physiol C Toxicol Pharmacol, 2016, 179, 72-78  [:26358403]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: