Record in detail


General Info

  • lamp_id:L11A013094
  • Name:CAP18 [I24C]
  • FullName:
  • Source:
  • Mass:4423.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:11.8
  • Activity:Gram+Gram-Mammalian Cell
  • Sequence
        GLRKRLRKFRNKIKEKLKKIGQKCQGLLPKLAPRTDY
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  13094

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A013094    From 1 To 37 E-value: 0.000000000000002 Score: 72.8
        GLRKRLRKFRNKIKEKLKKIGQKCQGLLPKLAPRTDY
  • 2. L11A013097    From 1 To 37 E-value: 0.00000000000001 Score: 70.1
        GLRKRLRKFRNKIKEKLKKIGQKSQGLLPKLAPRTDY
  • 3. L01A000997    From 1 To 37 E-value: 0.00000000000002 Score: 69.7
        GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
  • 4. L11A013096    From 1 To 37 E-value: 0.00000000000002 Score: 69.3
        GLRKRLRKFRNKIKEKLKKIGQKHQGLLPKLAPRTDY
  • 5. L11A011800    From 1 To 37 E-value: 0.00000000000002 Score: 69.3
        GLRKRLRKFRNKIKEKLKKIGQKNQGLLPKLAPRTDY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Ebbensgaard A, Mordhorst H, Overgaard MT, Aarestrup FM, Hansen EB
  •   Title:Dissection of the antimicrobial and hemolytic activity of Cap18: Generation of Cap18 derivatives with enhanced specificity
  •   Journal:PLoS One, 2018, 13, e0197742  [:29852015]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: