Record in detail


General Info

  • lamp_id:L11A013462
  • Name:Defensin-like peptide 2, DLP2
  • FullName:
  • Source: Hermetia illucens
  • Mass:4277 Da
  • Sequence Length:40 aa
  • Isoelectric Point:8.64
  • Activity:Gram+Gram-CancerMammalian Cell
  • Sequence
        ATCDLLSPFKVGHAACALHCIAMGRRGGWCDGRAVCNCRR
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:DBAASP  13462

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A013462    From 1 To 40 E-value: 2e-18 Score: 82.8
        ATCDLLSPFKVGHAACALHCIAMGRRGGWCDGRAVCNCRR
  • 2. L12A09191|    From 59 To 98 E-value: 0.000000000002 Score: 62.8
        ATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTCRR
  • 3. L01A002833    From 1 To 40 E-value: 0.000000000005 Score: 61.6
        ATCDLLSAFGVGHAACAAHCIGHGYRGGYCNSKAVCTCRR
  • 4. L05ADEF403    From 1 To 40 E-value: 0.00000000002 Score: 59.7
        ATCDLLSFLNVKDAACAAHCLAKGYRGGYCDGRKVCNCRR
  • 5. L03A000005    From 1 To 39 E-value: 0.00000000002 Score: 59.7
        ATCDLLSFLNVNHAACAAHCLSKGYRGGYCDGKKVCNCR

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Li Z, Mao R, Teng D, Hao Y, Chen H, Wang X, Yang n, Wang J
  •   Title:Antibacterial and immunomodulatory activities of insect defensins-DLP2 and DLP4 against multidrug-resistant Staphylococcus aureus
  •   Journal:Sci Rep, 2017, 76, 12124  [:28935900]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: