Record in detail


General Info

  • lamp_id:L12A002725
  • Name:
  • FullName:
  • Source:
  • Mass:6057 Da
  • Sequence Length:55 aa
  • Isoelectric Point:9.44
  • Activity:Antiparasitic
  • Sequence
        GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKARPPFILG
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_02725

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A02725|    From 1 To 55 E-value: 1e-27 Score: 113
        GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKARPPFILG
  • 2. L12A02726|    From 1 To 55 E-value: 3e-27 Score: 112
        GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIPKQTCKCYKPMGYKTRPPFILG
  • 3. L11A009781    From 1 To 55 E-value: 2e-26 Score: 108
        GGFGCPFNIDNQGNCHNHCQSIRGRKGGYCHGIFKQTCKCYKPMGYKTRPPFILG
  • 4. L03A000241    From 37 To 73 E-value: 0.00000000005 Score: 58.2
        GFGCPLN---QGACHNHCRSIR-RRGGYCSGIIKQTCTCYR
  • 5. L12A11860|    From 15 To 51 E-value: 0.0000000002 Score: 56.6
        GFGCPLN---QGACHNHCRSIR-RRGGYCSGIIKQTCTCYR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Streptococcus mutans ATCC 25175  MIC:  32 μg/ml  ( )  
  •   2  Target:  Bacillus subtilis ATCC 62037  MIC:  4 μg/ml  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 15752  MIC:  16 μg/ml  ( )  
  •   4  Target:  Escherichia coli ATCC 27325  MIC:  8 μg/ml  ( )  
  •   5  Target:  Pseudomonas putida ATCC 17426  MIC:  16 μg/ml  ( )  
  •   6  Target:  Salmonella enteritidis ATCC 13076  MIC:  32 μg/ml  ( )  
  •   7  Target:  Cryptococcus neoformans ATCC 34881  MIC:  4 μg/ml  ( )  
  •   8  Target:  Saccharomyces cerevisiae ATCC 44774  MIC:  16 μg/ml  ( )  
  •   9  Target:  Candida albicans ATCC 10231  MIC:  32 μg/ml  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: