Record in detail


General Info

  • lamp_id:L12A004423
  • Name:
  • FullName:
  • Source:
  • Mass:4531.3 Da
  • Sequence Length:38 aa
  • Isoelectric Point:10.05
  • Activity:AntiGram_p,AntiGram_n,Antifungal,Antiparasitic,Antimalarial
  • Sequence
        GYYCPFRQDKCHRHCRSFGRKAGYCGNFLKRTCICVKK
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_04423

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A04423|    From 1 To 38 E-value: 2e-17 Score: 79.3
        GYYCPFRQDKCHRHCRSFGRKAGYCGNFLKRTCICVKK
  • 2. L01A002645    From 39 To 74 E-value: 1e-16 Score: 77
        GYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV
  • 3. L05ADEF501    From 2 To 39 E-value: 3e-16 Score: 75.9
        GCYCPFRQDKCHRHCRSFGRKAGYCGNFLKRTCICVKK
  • 4. L01A002628    From 39 To 76 E-value: 3e-16 Score: 75.5
        GYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICVMK
  • 5. L02A001755    From 2 To 37 E-value: 0.000000000000002 Score: 72.8
        GYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Human lung carcinoma A549  LC50:  1.1±0.1 μM  ( )  
  •   2  Target:  Escherichia coli ATCC 25726  MIC:  3.1 μM  ( )  
  •   3  Target:  Acinetobacter baumannii  MIC:  3.1 μM  ( )  
  •   4  Target:  Stenotrophomonas maltophilia  MIC:  1.6 μM  ( )  
  •   5  Target:  Klebsiella pneumoniae ATCC 700603  MIC:  6.25 μM  ( )  
  •   6  Target:  Pseudomonas aeruginosa ATCC 27853  MIC:  12.5 μM  ( )  
  •   7  Target:  Proteus mirabilis ATCC 25933  MIC:  >100 μM  ( )  
  •   8  Target:  Staphylococcus aureus ATCC 29213  MIC:  3.1 μM  ( )  
  •   9  Target:  Staphylococcus aureus ATCC 25923  MIC:  3.1 μM  ( )  
  •   10  Target:  Staphylococcus epidermidis RP62A  MIC:  1.6 μM  ( )  
  •   11  Target:  Staphylococcus epidermidis RP62A/1  MIC:  0.8 μM  ( )  
  •   12  Target:  Candida albicans ATCC 90028  MIC:  100 μM  ( )  

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: