Record in detail
General Info
- lamp_id:L12A004423
- Name:
- FullName:
- Source:
- Mass:4531.3 Da
- Sequence Length:38 aa
- Isoelectric Point:10.05
- Activity:AntiGram_p,AntiGram_n,Antifungal,Antiparasitic,Antimalarial
- Sequence
GYYCPFRQDKCHRHCRSFGRKAGYCGNFLKRTCICVKK - Function:
Cross-Linking
- Cross-linking
- 1 Database:dbAMP dbAMP_04423
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L12A04423| From 1 To 38 E-value: 2e-17 Score: 79.3
GYYCPFRQDKCHRHCRSFGRKAGYCGNFLKRTCICVKK - 2. L01A002645 From 39 To 74 E-value: 1e-16 Score: 77
GYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV - 3. L05ADEF501 From 2 To 39 E-value: 3e-16 Score: 75.9
GCYCPFRQDKCHRHCRSFGRKAGYCGNFLKRTCICVKK - 4. L01A002628 From 39 To 76 E-value: 3e-16 Score: 75.5
GYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICVMK - 5. L02A001755 From 2 To 37 E-value: 0.000000000000002 Score: 72.8
GYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV
Structure
- Domains
No domains found on LAMP database
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
- 1 Target: Human lung carcinoma A549 LC50: 1.1±0.1 μM ( )
- 2 Target: Escherichia coli ATCC 25726 MIC: 3.1 μM ( )
- 3 Target: Acinetobacter baumannii MIC: 3.1 μM ( )
- 4 Target: Stenotrophomonas maltophilia MIC: 1.6 μM ( )
- 5 Target: Klebsiella pneumoniae ATCC 700603 MIC: 6.25 μM ( )
- 6 Target: Pseudomonas aeruginosa ATCC 27853 MIC: 12.5 μM ( )
- 7 Target: Proteus mirabilis ATCC 25933 MIC: >100 μM ( )
- 8 Target: Staphylococcus aureus ATCC 29213 MIC: 3.1 μM ( )
- 9 Target: Staphylococcus aureus ATCC 25923 MIC: 3.1 μM ( )
- 10 Target: Staphylococcus epidermidis RP62A MIC: 1.6 μM ( )
- 11 Target: Staphylococcus epidermidis RP62A/1 MIC: 0.8 μM ( )
- 12 Target: Candida albicans ATCC 90028 MIC: 100 μM ( )
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
No references found on LAMP database
Comments
- Comments
No comments found on LAMP database