Record in detail


General Info

  • lamp_id:L12A005358
  • Name:
  • FullName:
  • Source:
  • Mass:7543.5 Da
  • Sequence Length:68 aa
  • Isoelectric Point:4.26
  • Activity:Antibacterial
  • Sequence
        KSLFLVLFLGMVSLSICEEEKRENEDEEKQEDDEQSEMKRGLWSTIKNVGKEAAIAAGKAVLGSLGEQ
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:dbAMP  dbAMP_05358

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A05358|    From 1 To 68 E-value: 1e-33 Score: 133
        KSLFLVLFLGMVSLSICEEEKRENEDEEKQEDDEQSEMKRGLWSTIKNVGKEAAIAAGKAVLGSLGEQ
  • 2. L12A06203|    From 6 To 57 E-value: 4e-18 Score: 81.6
        KSLFLVLFLGMVSLSICEEEKRENEDEAKQEDDEQSEMKRGLWSTIKNVGKE
  • 3. L12A06199|    From 6 To 57 E-value: 0.0000000000002 Score: 66.2
        KSLFLVLFLGMVSLSICEEEKRENEDEELQEDDEQSEMKRGLWSTIKNVGKE
  • 4. L12A06177|    From 6 To 75 E-value: 0.00000000001 Score: 60.5
        KSLFLVLFLGFVSVSICEEEKRQEDEDEHVEEGENQEEGSEEKRGLLSVLGSVAKHVLPHVVPVIAEHLG
  • 5. L12A06174|    From 6 To 57 E-value: 0.00000000002 Score: 59.7
        KSIFLALFLGMVSLSICEEEKRENEGEEEQEDDEQSEMKRGLWSTIKNVGKE

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Escherichia coli ATCC 11775  <5% Inhibi:  39 μM  ( )  
  •   2  Target:  Staphylococcus aureus ATCC 12600  (8-9)% Inh:  20-78 μM  ( )  
  •   3  Target:  Pseudomonas aeruginosa ATCC 19582  7% Inhibit:  78 μM  ( )  
  •   4  Target:  Pseudomonas aeruginosa ATCC 19582  <5% Inhibi:  20 μM  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: