Record in detail


General Info

  • lamp_id:L12A005621
  • Name:
  • FullName:
  • Source:
  • Mass:6420.7 Da
  • Sequence Length:54 aa
  • Isoelectric Point:11.48
  • Activity:Antimicrobial
  • Sequence
        LCLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFALECIRAIA
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A05621|    From 1 To 54 E-value: 3e-26 Score: 108
        LCLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFALECIRAIA
  • 2. L12A03254|    From 2 To 55 E-value: 1e-25 Score: 107
        LCLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFALACIRAIA
  • 3. L12A05622|    From 1 To 54 E-value: 1e-24 Score: 103
        LCLAAPRKNVRWCTISQPEWLKCHRWQWRMKKLGAPSITCVRRAFVLECIRAIT
  • 4. L07APD0091    From 3 To 54 E-value: 8e-24 Score: 100
        CLAAPRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFALACIREF
  • 5. L12A05624|    From 1 To 53 E-value: 0.00000000000002 Score: 69.7
        LCLAAPRKNVRWCTTSKAEAKKCSKFQVNMKKVGGPIVSCTRKASRQECIQAI

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities
  •   1  Target:  Salmonella typhimurium C77-31  MIC:  10.6 μg/ml  ( )  
  •   2  Target:  Salmonella pullorum C79-13  MIC:  10.6 μg/ml  ( )  
  •   3  Target:  Staphylococcus aureus ATCC 25923  MIC:  2.7 μg/ml  ( )  
  •   4  Target:  Staphylococcus epidermidis ATCC 12228  MIC:  10.6 μg/ml  ( )  

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: